PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009792283.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 219aa    MW: 25195.2 Da    PI: 8.8687
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009792283.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1353.1e-11116168557
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                     ++ rr+ +NRe+ArrsR RK++ +e+L++ +  L+  N++L +    ++ +++
  XP_009792283.1 116 RKRRRMVSNRESARRSRMRKQKHLENLRNQANRLKVGNRDLTNLFRLMTHQCQ 168
                     6789999**********************************966655555655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-10112176IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.645114156IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.19E-10116167No hitNo description
PfamPF001707.5E-8116168IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-7116189No hitNo description
CDDcd147028.11E-16117168No hitNo description
PROSITE patternPS000360119134IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MLSTFPALTL PTDGFFPHLF PAFDGGFTPW ECIEPAFLFP QKVEEEPVIS PEDSPPPEPV  60
ISNSGSGSDD SKPNSVHSSS GSDEPSRNNN NDNNTNCCPD KRKRKNTASN RDIDERKRRR  120
MVSNRESARR SRMRKQKHLE NLRNQANRLK VGNRDLTNLF RLMTHQCQLV QCDNERLRTE  180
SALLRQRLEG IRQILLARQL EQFNAYSAWA CNNMEQRPQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102119KRKNTASNRDIDERKRRR
2115119RKRRR
3115136RKRRRMVSNRESARRSRMRKQK
4128135RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792283.11e-162PREDICTED: basic leucine zipper 43-like
RefseqXP_016440079.11e-162PREDICTED: basic leucine zipper 43-like
TrEMBLM1BXK21e-112M1BXK2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000552141e-111(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22850.25e-34basic leucine-zipper 6